Recombinant Rat 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 (Hsd3b1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.

Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance; additional charges will apply.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.

The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
Hsd3b1; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I; 3-beta-HSD I; 3-beta-hydroxy-5-ene steroid dehydrogenase; 3-beta-hydroxy-Delta(5-steroid dehydrogenase; 3-beta-hydroxysteroid 3-dehydrogenase; Delta-5-3-ketosteroid isomerase; Dihydrotestosterone oxidoreductase; Steroid Delta-isomerase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-373
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Hsd3b1
Target Protein Sequence
PGWSCLVTGAGGFVGQRIIRMLVQEKELQEVRALDKVFRPETKEEFSKLQTKAKVTMLEG DILDAQYLRRACQGISVVIHTAAVIDVSHVLPRQTILDVNLKGTQNILEACVEASVPAFI YCSTVDVAGPNSYKKIILNGHEEEHHESTWSDAYPYSKRMAEKAVLAANGSILKNGGTLH TCALRPMYIYGERSPFLSVMILAALKNKGILNVTGKFSIANPVYVGNVAWAHILAARGLR DPKKSQNVQGQFYYISDDTPHQSYDDLNCTLSKEWGLRLDSSWSLPLPLLYWLAFLLETV SFLLRPFYNYRPPFNCHLVTLSNSKFTFSYKKAQRDLGYVPLVSWEEAKQKTSEWIGTLV EQHRETLDTKSQ
Uniprot No.

Target Background

Function

3β-hydroxysteroid dehydrogenase/Δ5→4-isomerase type 1 (HSD3B1) is a bifunctional enzyme crucial for steroid hormone biosynthesis. It catalyzes the oxidation and isomerization of 3β-hydroxy-Δ5-steroid precursors to 3-oxo-Δ4-steroids. Specifically, it converts pregnenolone to progesterone, dehydroepiandrosterone (DHEA) to 4-androstenedione, and androstenediol to testosterone. Furthermore, HSD3B1 interconverts 3β-hydroxy and 3-oxo-5α-androstane steroids, influencing the bioavailability of active forms. For example, it converts dihydrotestosterone to the inactive 5α-androstanediol, which does not bind to the androgen receptor (AR). It also converts androstanedione, a precursor of testosterone and estrone, to epiandrosterone. HSD3B1 utilizes NAD+ as the preferred electron donor for 3β-hydroxysteroid dehydrogenase activity and NADPH for 3-ketosteroid reductase activity.

Gene References Into Functions
  1. L-tyrosine significantly inhibited 3β-HSD activity in cultured luteal cells. PMID: 21166213
  2. cAMP mediates the transcriptional regulation of Hsd3b1 in Leydig cells (both normal and tumor cells); luteinizing hormone appears necessary for maintaining testicular Hsd3b1 expression. PMID: 22217836
  3. Upregulation of AR and 3βHSD in testosterone-impaired Leydig cells may maintain steroidogenic function and prevent its loss. PMID: 21427060
Database Links

KEGG: rno:360348

UniGene: Rn.128814

Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.
Tissue Specificity
Adrenal glands, kidney, testes and ovaries.

Q&A

What is the function of 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 (Hsd3b1)?

3β-hydroxysteroid dehydrogenase/Δ⁵-Δ⁴ isomerase (3β-HSD) isoenzymes catalyze a critical step in steroid hormone biosynthesis. These enzymes are responsible for the oxidation and isomerization of Δ⁵-3β-hydroxysteroid precursors into Δ⁴-ketosteroids, an essential reaction in the production of all classes of active steroid hormones . In rats, Hsd3b1 plays a key role in the peripheral conversion of adrenal dehydroepiandrosterone (DHEA) to more potent androgens. This enzyme represents a rate-limiting step in the steroidogenic pathway and is crucial for normal endocrine function in various tissues.

How does rat Hsd3b1 differ from human HSD3B1?

While rat Hsd3b1 and human HSD3B1 share fundamental enzymatic functions in steroid metabolism, there are notable species-specific differences:

  • Expression patterns: In humans, the type I isoenzyme (HSD3B1) is predominantly expressed in placenta and peripheral tissues, whereas the type II isoenzyme (HSD3B2) is expressed in adrenal glands, ovaries, and testes . Rats have a somewhat different tissue distribution pattern.

  • Genetic polymorphisms: Humans possess a well-characterized germline missense-encoding polymorphism in HSD3B1. The adrenal restrictive HSD3B1(1245A) allele limits conversion, while the adrenal permissive HSD3B1(1245C) allele increases DHEA metabolism to potent androgens . These specific polymorphisms are not identical in rats.

  • Evolutionary context: Phylogenetic analyses suggest that the need for different 3β-HSD genes occurred late in mammalian evolution, with subsequent evolution occurring in lineage-specific patterns . This explains both the similarities and differences observed between rat and human orthologs.

What methodologies are available for detecting Hsd3b1 in rat samples?

Several established methodologies are available for detecting and quantifying Hsd3b1 in rat samples:

  • ELISA assays: Sandwich ELISA kits offer quantitative detection of Hsd3b1 in rat serum, plasma, tissue homogenates, cell lysates, and cell culture supernatants. These typically provide sensitivities around 0.063ng/mL with detection ranges of 0.156-10ng/mL .

  • Western blotting: Multiple antibodies are available for Western blot detection of Hsd3b1 in rat samples, allowing for protein expression analysis .

  • Immunohistochemistry (IHC): Polyclonal antibodies are available that react with rat Hsd3b1 for immunohistochemical analysis of tissue sections .

  • Immunofluorescence (IF): For cellular localization studies, antibodies compatible with immunofluorescence techniques can be used .

  • PCR-based genotyping: For genetic studies of Hsd3b1 variants, PCR-based approaches similar to those used for human sample analysis can be adapted for rat specimens .

How can researchers effectively evaluate Hsd3b1 enzymatic activity in vitro?

Effective evaluation of Hsd3b1 enzymatic activity requires carefully designed experimental protocols:

  • Substrate selection: Using appropriate substrates such as pregnenolone or DHEA is critical. The choice depends on whether you're studying the dehydrogenase or isomerase activity of the enzyme.

  • Cofactor requirements: Ensure adequate NAD+ is available as a cofactor for the dehydrogenase reaction. The standard assay conditions include:

    • Buffer: 20mM Tris-HCl, pH 7.4

    • NAD+ concentration: 0.5mM

    • Substrate concentration: 0.1-1μM (depending on specific experimental goals)

    • Incubation temperature: 37°C

  • Product analysis: High-performance liquid chromatography (HPLC) or liquid chromatography-mass spectrometry (LC-MS) are preferred methods for quantitative analysis of reaction products.

  • Kinetic analysis: For detailed enzyme characterization, determine Km and Vmax values using varying substrate concentrations. Recent studies using purified enzymes have characterized structure-function relationships responsible for kinetic differences and coenzyme specificity .

  • Inhibitor studies: Competitive inhibitors can provide insights into the active site structure and catalytic mechanism.

What research models are most appropriate for studying the role of Hsd3b1 in steroid-dependent disease pathways?

When selecting research models to study Hsd3b1 in disease contexts, consider these approaches:

  • In vitro cell models:

    • Primary steroidogenic cells isolated from rat adrenal glands, testes, or ovaries

    • Established cell lines that express Hsd3b1 either naturally or through genetic modification

    • These models are particularly useful for signaling pathway studies, as evidence suggests that multiple signal transduction pathways regulate Hsd3b1 expression

  • Genetically modified rodent models:

    • Conditional knockout models targeting Hsd3b1 in specific tissues

    • Knockin models incorporating specific mutations to study structure-function relationships

    • Transgenic overexpression models to study the effects of enhanced enzymatic activity

  • Disease-specific models:

    • For studying asthma and glucocorticoid responsiveness, models similar to those used in the Severe Asthma Research Program could be adapted for rats

    • For oncology research, hormone-dependent cancer models that incorporate Hsd3b1 pathway analysis would be appropriate

  • Translational models:

    • When studying the effects of genetic polymorphisms, careful consideration of species differences is essential, as human HSD3B1 genetic variations have been shown to affect clinical outcomes in conditions like asthma and prostate cancer

What are the current understanding and methodological approaches for studying transcriptional regulation of the Hsd3b1 gene?

The transcriptional regulation of Hsd3b1 involves multiple mechanisms and can be studied through various methodological approaches:

  • Key transcriptional regulators:

    • Nuclear receptors: Steroidogenic factor-1 (SF-1) and dosage-sensitive sex reversal adrenal hypoplasia congenita critical region on the X chromosome gene 1 (DAX-1) play important roles in HSD3B gene regulation

    • STAT proteins: STAT5 and STAT6 are involved in transcriptional activation of the HSD3B promoter

    • Growth factors: Epidermal growth factor (EGF) requires intact STAT5 for HSD3B gene regulation

    • Cytokines: IL-4 and IL-13 induce HSD3B1 gene expression through STAT6 activation

  • Methodological approaches:

    • Promoter analysis: Reporter gene assays using constructs containing the Hsd3b1 promoter region linked to luciferase or other reporter genes

    • Chromatin immunoprecipitation (ChIP): To identify transcription factor binding sites within the Hsd3b1 promoter

    • EMSA (Electrophoretic Mobility Shift Assay): To confirm specific protein-DNA interactions

    • siRNA/shRNA knockdown: To evaluate the importance of specific transcription factors

    • Signaling pathway inhibitors: To dissect the contributions of different signaling cascades

  • Integrated approaches: Evidence suggests that multiple signal transduction pathways are involved in regulating Hsd3b1 expression. Studies should consider potential interactions between STATs, nuclear receptors, and other signaling pathways such as those involving GATA proteins .

How do genetic polymorphisms in Hsd3b1 impact enzyme function and disease susceptibility?

Genetic polymorphisms in Hsd3b1 can significantly alter enzyme function and disease outcomes. The most well-characterized polymorphism in humans is the missense-encoding variant in HSD3B1:

What experimental considerations are important when studying the impact of Hsd3b1 on glucocorticoid responsiveness?

When investigating Hsd3b1's role in glucocorticoid responsiveness, researchers should consider:

  • Substrate availability:

    • Glucocorticoids suppress DHEA-sulfate levels, which serves as the substrate for 3β-HSD1

    • Measuring DHEA-sulfate levels is essential to understand the substrate-enzyme relationship

  • Genotype stratification:

    • Stratify experimental subjects by Hsd3b1 genotype to detect differential responses

    • Consider using an additive model of inheritance, coding genotypes based on the number of specific alleles

  • Appropriate endpoints:

    • For respiratory studies, measure lung function parameters such as FEV₁PP (forced expiratory volume in 1 second, percent predicted)

    • Include both pre- and post-bronchodilator measurements for comprehensive assessment

  • Statistical analysis:

    • Include interaction terms between genotype and treatment in statistical models

    • For comparing means across genotype groups, use ANOVA with appropriate post-hoc tests (e.g., Tukey-Kramer Honest Significant Differences test)

    • For non-normal distributions, apply non-parametric tests such as Wilcoxon's rank sum test or Kruskal-Wallis one-way ANOVA

  • Confounding variables:

    • Control for relevant covariates such as age, performance status, and concurrent medications

    • Consider the impact of planned treatments (e.g., radiotherapy) on outcomes

What are the recommended approaches for measuring Hsd3b1 enzyme activity in complex biological samples?

Measuring Hsd3b1 enzyme activity in complex biological samples requires careful methodological considerations:

  • Sample preparation:

    • For tissue samples: Prepare microsomes or mitochondrial fractions to enrich for Hsd3b1

    • For cell culture: Use cell homogenates or purified membrane fractions

    • Buffer composition typically includes 20mM Tris-HCl (pH 7.4), 250mM sucrose, and protease inhibitors

  • Activity assays:

    • Spectrophotometric methods: Monitor NAD+ reduction at 340nm in the presence of appropriate substrates

    • Radiometric assays: Using radiolabeled substrates (³H-pregnenolone or ³H-DHEA) followed by product separation and quantification

    • LC-MS/MS approaches: For highly specific and sensitive measurements of substrate conversion to products

  • Controls and validation:

    • Include positive controls (samples with known Hsd3b1 activity)

    • Negative controls (heat-inactivated samples or specific inhibitors)

    • Validate assay specificity using antibody inhibition or genetic knockdown approaches

  • Analytical considerations:

    • Account for potential interference from other dehydrogenases in complex samples

    • Consider the influence of endogenous inhibitors or activators

    • Normalize activity to protein concentration or specific cell markers

  • Data analysis:

    • Calculate enzyme kinetic parameters (Km, Vmax) when appropriate

    • Consider the ratio of different enzymatic activities (dehydrogenase vs. isomerase)

    • Compare results across different experimental conditions or genotypes

What expression systems are most effective for producing functional recombinant rat Hsd3b1?

Selection of an appropriate expression system is critical for producing functional recombinant rat Hsd3b1:

  • Mammalian expression systems:

    • HEK293 cells: Provide proper post-translational modifications and folding environment

    • CHO cells: Useful for larger-scale production with mammalian processing

    • Considerations: Use vectors with strong promoters (CMV, EF1α) and appropriate secretion signals if needed

  • Insect cell expression:

    • Sf9 or High Five cells: Using baculovirus expression vectors

    • Advantages: Higher yields than mammalian systems while maintaining most post-translational modifications

    • Protocol notes: Optimize infection MOI and harvest timing for maximum expression

  • Bacterial expression systems:

    • E. coli strains: BL21(DE3), Rosetta, or Origami for disulfide bond formation

    • Considerations: May require refolding procedures as Hsd3b1 is a membrane-associated protein

    • Tags: N-terminal His-tags generally perform better than C-terminal tags for purification

  • Yeast expression systems:

    • Pichia pastoris: Suitable for secreted protein production

    • Saccharomyces cerevisiae: Useful when studying membrane integration

  • Purification strategies:

    • For His-tagged proteins: Ni-NTA affinity chromatography under native or denaturing conditions

    • Additional purification: Ion exchange or size exclusion chromatography

    • Detergent considerations: Use mild detergents (0.1% Triton X-100 or DDM) to maintain enzyme activity

How can researchers design experiments to investigate structure-function relationships in Hsd3b1?

Investigating structure-function relationships in Hsd3b1 requires systematic experimental approaches:

  • Site-directed mutagenesis strategies:

    • Target conserved residues identified through sequence alignment across species

    • Focus on residues implicated in catalysis, substrate binding, or membrane association

    • Create systematic alanine scanning mutants for comprehensive analysis

  • Functional assays to assess mutant proteins:

    • Measure both dehydrogenase and isomerase activities to detect differential effects

    • Determine kinetic parameters (Km, Vmax, kcat) for different substrates

    • Assess coenzyme specificity and binding affinity (NAD+ vs. NADP+)

  • Structural biology approaches:

    • X-ray crystallography of purified protein (may require membrane protein crystallization techniques)

    • Cryo-EM for structural determination without crystallization

    • Homology modeling based on related proteins with known structures

  • Domain analysis:

    • Create chimeric proteins with domains from different isoenzymes to identify regions responsible for specific functions

    • Use truncation mutants to define minimal functional units

  • Data analysis framework:

    • Correlate structural modifications with changes in enzyme kinetics

    • Use molecular dynamics simulations to predict effects of mutations

    • Apply statistical methods to identify significant structure-function relationships

What are the key considerations when designing antibodies for detecting rat Hsd3b1 in various experimental applications?

Designing effective antibodies for rat Hsd3b1 detection requires careful planning:

  • Epitope selection:

    • N-terminal epitopes (AA 26-55) have been successful for antibodies reactive across multiple species

    • Internal regions can provide specificity for rat Hsd3b1 versus other isoforms

    • C-terminal epitopes may be useful for specific applications but could be less accessible in native proteins

  • Antibody format considerations:

    • Monoclonal antibodies: Provide consistency across experiments and batches

    • Polyclonal antibodies: Often provide stronger signals through multiple epitope recognition

    • Application-specific optimization: Different epitopes may work better for Western blot versus immunohistochemistry

  • Validation strategies:

    • Positive controls: Tissues known to express Hsd3b1 (adrenal gland, ovary)

    • Negative controls: Tissues lacking Hsd3b1 expression or knockout samples

    • Peptide competition assays to confirm specificity

    • Cross-reactivity testing with related isoforms

  • Application-specific considerations:

    • Western blotting: Denaturing conditions may expose different epitopes than native proteins

    • Immunohistochemistry: Fixation methods can affect epitope accessibility

    • Immunofluorescence: Consider subcellular localization patterns

    • ELISA: Antibody pairs must recognize non-overlapping epitopes

  • Available validated antibodies:

    • Several commercial antibodies have been validated for rat Hsd3b1 detection in Western blot, ELISA, immunohistochemistry, and immunofluorescence applications

    • Both rabbit and mouse host antibodies are available, providing flexibility for multi-color immunostaining

Properties of Rat HSD3B1 ELISA detection systems

ParameterSpecificationNotes
Sensitivity0.063 ng/mLLower limit of detection
Detection Range0.156-10 ng/mLLinear quantification range
ELISA TypeSandwichFor specific quantification
Sample TypesSerum, plasma, tissue homogenates, cell lysates, cell culture supernatantsMultiple sample compatibility
Cross-ReactivityRat-specificLimited cross-species reactivity
PrecisionIntra-assay CV <8%, Inter-assay CV <10%Typical performance metrics
RecoveryMatrix-specific spiking recovery between 85-115%Validates accuracy across sample types

Data derived from commercial ELISA kit specifications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.